SILENT KILLERPanel

Current Path: > > usr > > bin


Operation   : Linux premium107.web-hosting.com 4.18.0-553.44.1.lve.el8.x86_64 #1 SMP Thu Mar 13 14:29:12 UTC 2025 x86_64
Software     : Apache
Server IP    : 198.54.126.246 | Your IP: 216.73.216.181
Domains      : 1034 Domain(s)
Permission   : [ 0555 ]

Files and Folders in: //usr//bin


Warning: filesize(): stat failed for //usr//bin/easy_install-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/easy_install-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137

Warning: filesize(): stat failed for //usr//bin/pip-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/pip-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137

Warning: filesize(): stat failed for //usr//bin/pip3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/pip3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137

Warning: filesize(): stat failed for //usr//bin/pydoc-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/pydoc-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137

Warning: filesize(): stat failed for //usr//bin/pydoc3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/pydoc3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137

Warning: filesize(): stat failed for //usr//bin/pyvenv-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/pyvenv-3 in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137

Warning: filesize(): stat failed for //usr//bin/unversioned-python in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 136

Warning: filemtime(): stat failed for //usr//bin/unversioned-python in /home/branxxtp/freemanvalue.com/wp-includes/random/bvo1o2h3/index.php on line 137
NameTypeSizeLast ModifiedActions
7za File 46 bytes October 04 2024 01:50:29.
GET File 16217 bytes April 22 2022 20:13:06.
Mail File 418704 bytes October 13 2019 00:19:50.
[ File 54864 bytes December 18 2025 13:54:40.
aclocal File 36478 bytes October 14 2023 20:00:43.
aclocal-1.16 File 36478 bytes October 14 2023 20:00:43.
addr2line File 34224 bytes December 18 2025 14:21:35.
animate File 12128 bytes April 01 2025 13:15:58.
ar File 63448 bytes December 18 2025 14:21:35.
arch File 38232 bytes December 18 2025 13:54:40.
arpaname File 12104 bytes November 06 2025 07:45:52.
as File 911264 bytes December 18 2025 14:21:35.
aspell File 163328 bytes April 18 2022 15:10:53.
at File 1276 bytes October 10 2022 10:23:17.
atq File 1278 bytes October 10 2022 10:23:17.
atrm File 1280 bytes October 10 2022 10:23:17.
autoconf File 14768 bytes August 13 2024 19:30:48.
autoheader File 8534 bytes August 13 2024 19:30:48.
autom4te File 32181 bytes August 13 2024 19:30:48.
automake File 257949 bytes October 14 2023 20:00:43.
automake-1.16 File 257949 bytes October 14 2023 20:00:43.
autoreconf File 21066 bytes August 13 2024 19:30:48.
autoscan File 17124 bytes August 13 2024 19:30:48.
autoupdate File 33872 bytes August 13 2024 19:30:48.
awk File 685848 bytes April 18 2022 15:56:05.
b2sum File 59072 bytes December 18 2025 13:54:40.
base32 File 42464 bytes December 18 2025 13:54:40.
base64 File 42488 bytes December 18 2025 13:54:40.
basename File 38312 bytes December 18 2025 13:54:40.
bash File 1154680 bytes August 26 2025 08:48:39.
bashbug-64 File 7348 bytes August 26 2025 08:48:31.
batch File 137 bytes October 10 2022 10:23:17.
bison File 448224 bytes October 12 2019 12:28:39.
bunzip2 File 37744 bytes January 28 2025 01:38:59.
bzcat File 37744 bytes January 28 2025 01:38:59.
bzcmp File 2128 bytes January 28 2025 01:38:58.
bzdiff File 2128 bytes January 28 2025 01:38:58.
bzgrep File 1677 bytes January 28 2025 01:38:58.
bzip2 File 37744 bytes January 28 2025 01:38:59.
bzip2recover File 16832 bytes January 28 2025 01:38:59.
bzless File 1259 bytes January 28 2025 01:38:58.
bzmore File 1259 bytes January 28 2025 01:38:58.
c++ File 1266616 bytes August 26 2025 09:47:24.
c++filt File 29584 bytes December 18 2025 14:21:35.
c89 File 224 bytes August 26 2025 09:45:19.
c99 File 215 bytes August 26 2025 09:45:19.
cagefs_enter.proxied File 1296 bytes January 20 2026 13:58:37.
cal File 67560 bytes February 04 2026 20:18:19.
captoinfo File 87360 bytes October 14 2023 18:54:49.
cat File 38360 bytes December 18 2025 13:54:40.
catchsegv File 3283 bytes December 08 2025 09:36:48.
cc File 1266576 bytes August 26 2025 09:47:26.
chgrp File 67864 bytes December 18 2025 13:54:40.
chmod File 63688 bytes December 18 2025 13:54:40.
chown File 71976 bytes December 18 2025 13:54:40.
chrt File 38080 bytes February 04 2026 20:18:19.
cksum File 38288 bytes December 18 2025 13:54:40.
cldetect File 10593 bytes December 24 2025 15:45:26.
clear File 12840 bytes October 14 2023 18:54:49.
clusterdb File 71920 bytes February 27 2024 08:25:00.
cmp File 106248 bytes May 04 2020 15:15:14.
col File 29704 bytes February 04 2026 20:18:19.
colcrt File 16872 bytes February 04 2026 20:18:19.
colrm File 25480 bytes February 04 2026 20:18:19.
column File 50656 bytes February 04 2026 20:18:19.
comm File 42560 bytes December 18 2025 13:54:40.
compare File 12136 bytes April 01 2025 13:15:58.
composite File 12120 bytes April 01 2025 13:15:58.
conjure File 12120 bytes April 01 2025 13:15:58.
convert File 12120 bytes April 01 2025 13:15:58.
cp File 151568 bytes December 18 2025 13:54:40.
cpan File 8370 bytes June 03 2025 14:32:21.
cpp File 1266552 bytes August 26 2025 09:47:25.
createdb File 71904 bytes February 27 2024 08:25:00.
createuser File 76416 bytes February 27 2024 08:25:00.
crontab File 1524 bytes April 06 2024 11:40:05.
crontab.cagefs File 55456 bytes January 20 2026 14:24:20.
csplit File 54968 bytes December 18 2025 13:54:40.
curl File 235600 bytes December 18 2025 14:22:12.
cut File 50704 bytes December 18 2025 13:54:40.
date File 108496 bytes December 18 2025 13:54:40.
dd File 79840 bytes December 18 2025 13:54:40.
delv File 43480 bytes November 06 2025 07:45:52.
df File 93272 bytes December 18 2025 13:54:40.
diff File 274440 bytes May 04 2020 15:15:14.
diff3 File 131688 bytes May 04 2020 15:15:14.
dig File 166072 bytes November 06 2025 07:45:52.
dir File 143256 bytes December 18 2025 13:54:40.
dircolors File 50744 bytes December 18 2025 13:54:40.
dirname File 34160 bytes December 18 2025 13:54:40.
display File 12128 bytes April 01 2025 13:15:58.
dnstap-read File 20920 bytes November 06 2025 07:45:52.
dropdb File 67608 bytes February 27 2024 08:25:00.
dropuser File 67576 bytes February 27 2024 08:25:00.
du File 109568 bytes December 18 2025 13:54:40.
easy_install-3 File bytes January 01 1970 00:00:00.
echo File 38248 bytes December 18 2025 13:54:40.
egrep File 28 bytes October 11 2019 15:15:56.
enc2xs File 41958 bytes October 13 2019 08:46:10.
enchant File 21584 bytes October 23 2019 20:03:55.
enchant-lsmod File 13408 bytes October 23 2019 20:03:55.
env File 42344 bytes December 18 2025 13:54:40.
eps2eps File 639 bytes June 03 2025 02:48:11.
eqn File 237728 bytes October 13 2019 14:29:41.
ex File 1180352 bytes October 12 2025 00:23:15.
expand File 42592 bytes December 18 2025 13:54:40.
expr File 50760 bytes December 18 2025 13:54:40.
factor File 88032 bytes December 18 2025 13:54:40.
false File 34120 bytes December 18 2025 13:54:40.
fc-cache File 132 bytes August 16 2021 11:04:22.
fc-cache-64 File 20840 bytes October 09 2021 09:02:09.
fc-cat File 16744 bytes October 09 2021 09:02:09.
fc-conflist File 12544 bytes October 09 2021 09:02:09.
fc-list File 12544 bytes October 09 2021 09:02:09.
fc-match File 16648 bytes October 09 2021 09:02:09.
fc-pattern File 12552 bytes October 09 2021 09:02:09.
fc-query File 12536 bytes October 09 2021 09:02:09.
fc-scan File 12552 bytes October 09 2021 09:02:09.
fc-validate File 16648 bytes October 09 2021 09:02:09.
fgrep File 28 bytes October 11 2019 15:15:56.
file File 25280 bytes October 07 2025 06:30:49.
find File 228632 bytes December 18 2025 14:57:01.
flex File 438728 bytes October 12 2019 12:33:17.
flex++ File 438728 bytes October 12 2019 12:33:17.
flock File 33992 bytes February 04 2026 20:18:19.
fmt File 46584 bytes December 18 2025 13:54:40.
fold File 42408 bytes December 18 2025 13:54:40.
free File 21288 bytes October 14 2023 20:31:02.
freetype-config File 4416 bytes March 31 2025 19:37:30.
funzip File 37504 bytes June 03 2025 02:10:12.
g++ File 1266616 bytes August 26 2025 09:47:24.
gawk File 685848 bytes April 18 2022 15:56:05.
gcc File 1266576 bytes August 26 2025 09:47:26.
gcc-ar File 37536 bytes August 26 2025 09:47:26.
gcc-nm File 37536 bytes August 26 2025 09:47:26.
gcc-ranlib File 37536 bytes August 26 2025 09:47:26.
gcov File 1377408 bytes August 26 2025 09:47:26.
gcov-dump File 584664 bytes August 26 2025 09:47:26.
gcov-tool File 622360 bytes August 26 2025 09:47:26.
gem File 542 bytes May 14 2025 12:40:38.
gencat File 25432 bytes December 08 2025 09:43:19.
geoiplookup File 22416 bytes November 28 2019 22:06:01.
geoiplookup6 File 22168 bytes November 28 2019 22:06:01.
geqn File 237728 bytes October 13 2019 14:29:41.
getconf File 33240 bytes December 08 2025 09:43:19.
getent File 33920 bytes December 08 2025 09:43:19.
getopt File 21024 bytes February 04 2026 20:18:19.
ghostscript File 12648 bytes June 03 2025 02:48:22.
git File 3845928 bytes July 23 2025 06:59:57.
git-receive-pack File 3845928 bytes July 23 2025 06:59:57.
git-shell File 2236688 bytes July 23 2025 06:59:57.
git-upload-archive File 3845928 bytes July 23 2025 06:59:57.
git-upload-pack File 3845928 bytes July 23 2025 06:59:57.
gm File 8008 bytes March 28 2022 15:50:37.
gmake File 240968 bytes April 18 2022 16:38:34.
gneqn File 908 bytes October 13 2019 14:29:37.
gnroff File 3312 bytes October 13 2019 14:29:39.
gpg File 1090344 bytes January 16 2026 01:48:25.
gpg-agent File 429360 bytes January 16 2026 01:48:25.
gpg-error File 34976 bytes October 12 2019 12:20:46.
gpg-zip File 3525 bytes January 16 2026 01:48:21.
gpgsplit File 89112 bytes January 16 2026 01:48:25.
gpgv File 462344 bytes January 16 2026 01:48:25.
gpic File 300896 bytes October 13 2019 14:29:41.
gprof File 105832 bytes December 18 2025 14:21:35.
grep File 198280 bytes October 11 2019 15:15:57.
groff File 127920 bytes October 13 2019 14:29:41.
grops File 195728 bytes October 13 2019 14:29:41.
grotty File 145304 bytes October 13 2019 14:29:41.
groups File 38288 bytes December 18 2025 13:54:40.
gs File 12648 bytes June 03 2025 02:48:22.
gsnd File 277 bytes June 03 2025 02:48:11.
gsoelim File 43576 bytes October 13 2019 14:29:41.
gtar File 459768 bytes August 26 2025 08:57:37.
gtbl File 158320 bytes October 13 2019 14:29:41.
gtroff File 824344 bytes October 13 2019 14:29:41.
gunzip File 2345 bytes April 27 2022 05:49:28.
gzexe File 6375 bytes April 27 2022 05:49:28.
gzip File 96944 bytes April 27 2022 05:49:29.
h2ph File 29382 bytes July 28 2025 08:08:32.
h2xs File 60866 bytes July 28 2025 08:07:09.
head File 46592 bytes December 18 2025 13:54:40.
hexdump File 58888 bytes February 04 2026 20:18:19.
host File 145704 bytes November 06 2025 07:45:52.
hostid File 34136 bytes December 18 2025 13:54:40.
hostname File 21664 bytes October 11 2019 13:06:51.
hunspell File 148168 bytes October 13 2019 08:33:15.
iconv File 62904 bytes December 08 2025 09:43:19.
id File 46528 bytes December 18 2025 13:54:40.
identify File 12128 bytes April 01 2025 13:15:58.
idn File 40352 bytes October 13 2019 16:55:35.
ifnames File 4128 bytes August 13 2024 19:30:48.
import File 12120 bytes April 01 2025 13:15:58.
infocmp File 62512 bytes October 14 2023 18:54:49.
infotocap File 87360 bytes October 14 2023 18:54:49.
install File 159912 bytes December 18 2025 13:54:40.
instmodsh File 4194 bytes October 13 2019 08:55:21.
ionice File 29680 bytes February 04 2026 20:18:19.
ipcrm File 29688 bytes February 04 2026 20:18:19.
ipcs File 54680 bytes February 04 2026 20:18:19.
isosize File 25480 bytes February 04 2026 20:18:19.
ispell File 988 bytes April 18 2022 15:10:51.
join File 54984 bytes December 18 2025 13:54:40.
kill File 38176 bytes February 04 2026 20:18:19.
ld File 1789080 bytes December 18 2025 14:21:35.
ld.bfd File 1789080 bytes December 18 2025 14:21:35.
ldd File 5441 bytes December 08 2025 09:36:51.
less File 177928 bytes July 02 2024 20:10:37.
lessecho File 12696 bytes July 02 2024 20:10:37.
lesskey File 22520 bytes July 02 2024 20:10:37.
lesspipe.sh File 3143 bytes July 02 2024 19:57:10.
lex File 438728 bytes October 12 2019 12:33:17.
libnetcfg File 15775 bytes July 28 2025 08:08:32.
libtool File 367724 bytes October 11 2019 14:55:28.
libtoolize File 129197 bytes October 11 2019 14:55:28.
link File 34136 bytes December 18 2025 13:54:40.
ln File 72192 bytes December 18 2025 13:54:40.
locale File 57800 bytes December 08 2025 09:43:19.
localedef File 314848 bytes December 08 2025 09:43:19.
logger File 51184 bytes February 04 2026 20:18:19.
login File 41944 bytes February 04 2026 20:18:19.
logname File 34144 bytes December 18 2025 13:54:40.
look File 16856 bytes February 04 2026 20:18:19.
ls File 143248 bytes December 18 2025 13:54:40.
lynx File 1928720 bytes April 18 2022 21:01:05.
m4 File 190016 bytes October 11 2019 14:41:40.
mail File 418704 bytes October 13 2019 00:19:50.
mailx File 418704 bytes October 13 2019 00:19:50.
make File 240968 bytes April 18 2022 16:38:34.
make-dummy-cert File 610 bytes January 08 2026 13:57:14.
mariadb File 5605864 bytes November 28 2025 17:50:10.
mariadb-access File 112112 bytes November 28 2025 17:50:11.
mariadb-admin File 5126776 bytes November 28 2025 17:50:10.
mariadb-binlog File 5411576 bytes November 28 2025 17:50:10.
mariadb-check File 5123960 bytes November 28 2025 17:50:10.
mariadb-conv File 4815712 bytes November 28 2025 17:50:10.
mariadb-convert-table-format File 4386 bytes November 28 2025 17:50:11.
mariadb-dump File 5229744 bytes November 28 2025 17:50:10.
mariadb-dumpslow File 8382 bytes November 28 2025 17:50:11.
mariadb-embedded File 25792464 bytes November 28 2025 17:50:11.
mariadb-find-rows File 3433 bytes November 28 2025 17:50:11.
mariadb-hotcopy File 35497 bytes November 28 2025 17:50:11.
mariadb-import File 5114744 bytes November 28 2025 17:50:10.
mariadb-plugin File 4794424 bytes November 28 2025 17:50:10.
mariadb-secure-installation File 13993 bytes November 28 2025 17:50:11.
mariadb-setpermission File 18128 bytes November 28 2025 17:50:11.
mariadb-show File 5113136 bytes November 28 2025 17:50:10.
mariadb-slap File 5132600 bytes November 28 2025 17:50:10.
mariadb-tzinfo-to-sql File 4793896 bytes November 28 2025 17:50:11.
mariadb-waitpid File 4781272 bytes November 28 2025 17:50:11.
mc File 1360320 bytes October 18 2019 20:38:40.
mcdiff File 1360320 bytes October 18 2019 20:38:40.
mcedit File 1360320 bytes October 18 2019 20:38:40.
mcookie File 34064 bytes February 04 2026 20:18:19.
mcview File 1360320 bytes October 18 2019 20:38:40.
md5sum File 46632 bytes December 18 2025 13:54:40.
mesg File 16752 bytes February 04 2026 20:18:19.
mkdir File 84680 bytes December 18 2025 13:54:40.
mkfifo File 68056 bytes December 18 2025 13:54:40.
mktemp File 46760 bytes December 18 2025 13:54:40.
mogrify File 12120 bytes April 01 2025 13:15:58.
montage File 12120 bytes April 01 2025 13:15:58.
more File 46016 bytes February 04 2026 20:18:19.
msql2mysql File 1446 bytes November 28 2025 17:50:11.
mv File 147408 bytes December 18 2025 13:54:40.
my_print_defaults File 4781680 bytes November 28 2025 17:50:10.
mysql File 5605864 bytes November 28 2025 17:50:10.
mysql_config File 4574 bytes November 28 2025 17:50:41.
mysql_find_rows File 3433 bytes November 28 2025 17:50:11.
mysql_waitpid File 4781272 bytes November 28 2025 17:50:11.
mysqlaccess File 112112 bytes November 28 2025 17:50:11.
mysqladmin File 5126776 bytes November 28 2025 17:50:10.
mysqlbinlog File 5411576 bytes November 28 2025 17:50:10.
mysqlcheck File 5123960 bytes November 28 2025 17:50:10.
mysqldump File 5229744 bytes November 28 2025 17:50:10.
mysqlimport File 5114744 bytes November 28 2025 17:50:10.
mysqlshow File 5113136 bytes November 28 2025 17:50:10.
mytop File 73757 bytes November 28 2025 17:50:11.
namei File 33896 bytes February 04 2026 20:18:19.
nano File 253888 bytes September 24 2024 02:16:19.
neqn File 908 bytes October 13 2019 14:29:37.
nice File 38224 bytes December 18 2025 13:54:40.
nl File 46648 bytes December 18 2025 13:54:40.
nm File 51584 bytes December 18 2025 14:21:35.
nohup File 38312 bytes December 18 2025 13:54:40.
nproc File 38304 bytes December 18 2025 13:54:40.
nroff File 3312 bytes October 13 2019 14:29:39.
nslookup File 149768 bytes November 06 2025 07:45:52.
nsupdate File 74808 bytes November 06 2025 07:45:52.
numfmt File 67216 bytes December 18 2025 13:54:40.
objcopy File 245832 bytes December 18 2025 14:21:35.
objdump File 429832 bytes December 18 2025 14:21:35.
od File 75576 bytes December 18 2025 13:54:40.
openssl File 763856 bytes January 08 2026 13:57:28.
pango-list File 12160 bytes October 08 2021 15:22:06.
pango-view File 58816 bytes October 08 2021 15:22:06.
passwd File 1284 bytes April 18 2022 22:59:33.
paste File 38280 bytes December 18 2025 13:54:40.
patch File 211416 bytes June 01 2020 15:14:25.
pathchk File 38224 bytes December 18 2025 13:54:40.
pdf2dsc File 698 bytes June 03 2025 02:48:11.
pdf2ps File 909 bytes June 03 2025 02:48:11.
perl File 12728 bytes July 28 2025 08:07:20.
perl5.26.3 File 12728 bytes July 28 2025 08:07:20.
perlbug File 45458 bytes July 28 2025 08:08:32.
perldoc File 118 bytes October 13 2019 11:53:57.
perlivp File 10813 bytes July 28 2025 08:07:09.
perlml File 7024 bytes August 10 2022 20:54:28.
perlthanks File 45458 bytes July 28 2025 08:08:32.
pg_dump File 409016 bytes February 27 2024 08:25:00.
pg_dumpall File 109680 bytes February 27 2024 08:25:00.
pg_restore File 177504 bytes February 27 2024 08:25:00.
pgrep File 29536 bytes October 14 2023 20:31:02.
php File 937 bytes April 03 2025 11:08:35.
pic File 300896 bytes October 13 2019 14:29:41.
piconv File 8271 bytes October 13 2019 08:46:10.
pinentry File 2404 bytes August 12 2018 17:18:10.
pinentry-curses File 79760 bytes November 24 2019 17:39:34.
ping File 67712 bytes October 14 2023 17:19:01.
pinky File 42456 bytes December 18 2025 13:54:40.
pip-3 File bytes January 01 1970 00:00:00.
pip3 File bytes January 01 1970 00:00:00.
pkg-config File 41000 bytes October 13 2019 06:57:31.
pkgconf File 41000 bytes October 13 2019 06:57:31.
pkill File 29536 bytes October 14 2023 20:31:02.
pl2pm File 4533 bytes July 28 2025 08:08:16.
pmap File 33568 bytes October 14 2023 20:31:02.
pod2html File 4134 bytes July 28 2025 08:08:32.
pod2man File 15034 bytes October 13 2019 14:12:32.
pod2text File 10803 bytes October 13 2019 14:12:32.
pod2usage File 3948 bytes October 13 2019 11:57:18.
podchecker File 3658 bytes October 13 2019 11:46:35.
podselect File 2527 bytes October 13 2019 11:52:55.
post-grohtml File 244456 bytes October 13 2019 14:29:41.
pr File 84120 bytes December 18 2025 13:54:40.
pre-grohtml File 133688 bytes October 13 2019 14:29:41.
precat File 5656 bytes April 18 2022 15:10:50.
preunzip File 5656 bytes April 18 2022 15:10:50.
prezip File 5656 bytes April 18 2022 15:10:50.
prezip-bin File 12264 bytes April 18 2022 15:10:53.
printenv File 34120 bytes December 18 2025 13:54:40.
printf File 54848 bytes December 18 2025 13:54:40.
prove File 13562 bytes October 13 2019 12:42:34.
ps File 137984 bytes October 14 2023 20:31:02.
ps2ascii File 631 bytes June 03 2025 02:48:11.
ps2epsi File 2752 bytes June 03 2025 02:48:11.
ps2pdf File 272 bytes June 03 2025 02:48:11.
ps2pdf12 File 215 bytes June 03 2025 02:48:11.
ps2pdf13 File 215 bytes June 03 2025 02:48:11.
ps2pdf14 File 215 bytes June 03 2025 02:48:11.
ps2pdfwr File 1097 bytes June 03 2025 02:48:11.
ps2ps File 647 bytes June 03 2025 02:48:11.
ps2ps2 File 669 bytes June 03 2025 02:48:11.
psql File 659792 bytes February 27 2024 08:25:00.
ptx File 79864 bytes December 18 2025 13:54:40.
pwd File 38320 bytes December 18 2025 13:54:40.
pwdx File 12984 bytes October 14 2023 20:31:02.
pydoc-3 File bytes January 01 1970 00:00:00.
pydoc3 File bytes January 01 1970 00:00:00.
python2 File 8032 bytes April 10 2024 04:58:50.
python2.7 File 8032 bytes April 10 2024 04:58:50.
python3 File 11872 bytes February 05 2026 20:05:34.
python3.6 File 11872 bytes February 05 2026 20:05:34.
python3.6m File 11872 bytes February 05 2026 20:05:34.
pyvenv-3 File bytes January 01 1970 00:00:00.
ranlib File 63456 bytes December 18 2025 14:21:35.
readelf File 639528 bytes December 18 2025 14:21:35.
readlink File 46984 bytes December 18 2025 13:54:40.
realpath File 51144 bytes December 18 2025 13:54:40.
recode File 48160 bytes October 18 2019 15:18:02.
reindexdb File 72008 bytes February 27 2024 08:25:00.
rename File 16896 bytes February 04 2026 20:18:19.
renew-dummy-cert File 725 bytes January 08 2026 13:57:14.
renice File 16856 bytes February 04 2026 20:18:19.
replace File 4763664 bytes November 28 2025 17:50:11.
reset File 25352 bytes October 14 2023 18:54:49.
rev File 12760 bytes February 04 2026 20:18:19.
rm File 72064 bytes December 18 2025 13:54:40.
rmdir File 46552 bytes December 18 2025 13:54:40.
rnano File 253888 bytes September 24 2024 02:16:19.
rsync File 522392 bytes June 03 2025 02:02:49.
ruby File 12128 bytes May 14 2025 12:43:45.
run-with-aspell File 85 bytes April 18 2022 15:10:50.
rvi File 1180352 bytes October 12 2025 00:23:15.
rview File 1180352 bytes October 12 2025 00:23:15.
rvim File 3067744 bytes October 12 2025 00:23:15.
scalar File 2290912 bytes July 23 2025 06:59:57.
scl File 37752 bytes April 01 2023 16:10:31.
scl_enabled File 258 bytes August 25 2017 08:23:02.
scl_source File 1863 bytes April 01 2023 16:10:31.
scp File 105304 bytes December 18 2025 02:27:48.
screen File 494040 bytes May 05 2021 10:04:06.
script File 37680 bytes February 04 2026 20:18:19.
sdiff File 107856 bytes May 04 2020 15:15:14.
sed File 118248 bytes April 18 2022 21:41:04.
selectorctl File 7812 bytes December 15 2025 14:07:47.
seq File 54728 bytes December 18 2025 13:54:40.
setsid File 16768 bytes February 04 2026 20:18:19.
setterm File 46208 bytes February 04 2026 20:18:19.
sftp File 163576 bytes December 18 2025 02:27:48.
sh File 1154680 bytes August 26 2025 08:48:39.
sha1sum File 46640 bytes December 18 2025 13:54:40.
sha224sum File 46672 bytes December 18 2025 13:54:40.
sha256sum File 46680 bytes December 18 2025 13:54:40.
sha384sum File 46688 bytes December 18 2025 13:54:40.
sha512sum File 46680 bytes December 18 2025 13:54:40.
shred File 63336 bytes December 18 2025 13:54:40.
shuf File 59488 bytes December 18 2025 13:54:40.
size File 34048 bytes December 18 2025 14:21:35.
skill File 29488 bytes October 14 2023 20:31:02.
slabtop File 21344 bytes October 14 2023 20:31:02.
sleep File 38288 bytes December 18 2025 13:54:40.
snice File 29488 bytes October 14 2023 20:31:02.
soelim File 43576 bytes October 13 2019 14:29:41.
sort File 126432 bytes December 18 2025 13:54:40.
spell File 122 bytes April 18 2022 15:10:51.
splain File 19150 bytes July 28 2025 08:08:32.
split File 59440 bytes December 18 2025 13:54:40.
sprof File 29360 bytes December 08 2025 09:43:19.
sqlite3 File 1346512 bytes July 29 2025 01:27:56.
ssh File 775648 bytes December 18 2025 02:27:48.
ssh-add File 354416 bytes December 18 2025 02:27:48.
ssh-agent File 333400 bytes December 18 2025 02:27:48.
ssh-copy-id File 10694 bytes December 18 2025 02:27:46.
ssh-keygen File 437424 bytes December 18 2025 02:27:48.
ssh-keyscan File 438800 bytes December 18 2025 02:27:48.
stat File 88232 bytes December 18 2025 13:54:40.
stdbuf File 50688 bytes December 18 2025 13:54:40.
strace File 2029832 bytes January 28 2025 01:32:17.
stream File 12112 bytes April 01 2025 13:15:58.
strings File 38328 bytes December 18 2025 14:21:35.
strip File 245856 bytes December 18 2025 14:21:35.
stty File 79472 bytes December 18 2025 13:54:40.
sum File 46624 bytes December 18 2025 13:54:40.
sync File 38256 bytes December 18 2025 13:54:40.
tabs File 16952 bytes October 14 2023 18:54:49.
tac File 42488 bytes December 18 2025 13:54:40.
tail File 75912 bytes December 18 2025 13:54:40.
tar File 459768 bytes August 26 2025 08:57:37.
taskset File 38152 bytes February 04 2026 20:18:19.
tbl File 158320 bytes October 13 2019 14:29:41.
tclsh File 9256 bytes October 12 2019 00:25:32.
tclsh8.6 File 9256 bytes October 12 2019 00:25:32.
tee File 42472 bytes December 18 2025 13:54:40.
test File 54848 bytes December 18 2025 13:54:40.
tic File 87360 bytes October 14 2023 18:54:49.
timeout File 42864 bytes December 18 2025 13:54:40.
tload File 17160 bytes October 14 2023 20:31:02.
tmpwatch File 36320 bytes October 12 2019 11:32:29.
toe File 16848 bytes October 14 2023 18:54:49.
top File 124616 bytes October 14 2023 20:31:02.
touch File 96192 bytes December 18 2025 13:54:40.
tput File 25392 bytes October 14 2023 18:54:49.
tr File 50816 bytes December 18 2025 13:54:40.
traceroute File 72672 bytes March 11 2025 07:45:53.
troff File 824344 bytes October 13 2019 14:29:41.
true File 34128 bytes December 18 2025 13:54:40.
truncate File 42352 bytes December 18 2025 13:54:40.
tset File 25352 bytes October 14 2023 18:54:49.
tsort File 42488 bytes December 18 2025 13:54:40.
tty File 34112 bytes December 18 2025 13:54:40.
tzselect File 15370 bytes December 08 2025 09:36:35.
uapi File 1280 bytes January 10 2026 21:23:10.
ul File 21080 bytes February 04 2026 20:18:19.
uname File 38224 bytes December 18 2025 13:54:40.
unexpand File 46704 bytes December 18 2025 13:54:40.
uniq File 50832 bytes December 18 2025 13:54:40.
unlink File 34144 bytes December 18 2025 13:54:40.
unversioned-python File bytes January 01 1970 00:00:00.
unzip File 206728 bytes June 03 2025 02:10:12.
unzipsfx File 103912 bytes June 03 2025 02:10:12.
uptime File 12888 bytes October 14 2023 20:31:02.
users File 38288 bytes December 18 2025 13:54:40.
utmpdump File 29352 bytes February 04 2026 20:18:19.
vacuumdb File 80344 bytes February 27 2024 08:25:00.
vdir File 143256 bytes December 18 2025 13:54:40.
vi File 1180352 bytes October 12 2025 00:23:15.
view File 1180352 bytes October 12 2025 00:23:15.
vim File 3067744 bytes October 12 2025 00:23:15.
vimdiff File 3067744 bytes October 12 2025 00:23:15.
vimtutor File 2121 bytes October 12 2025 00:23:12.
vmstat File 37672 bytes October 14 2023 20:31:02.
watch File 29888 bytes October 14 2023 20:31:02.
wc File 50832 bytes December 18 2025 13:54:40.
wget File 533928 bytes August 13 2024 22:22:56.
whereis File 29976 bytes February 04 2026 20:18:19.
which File 30088 bytes August 26 2025 08:54:45.
who File 54880 bytes December 18 2025 13:54:40.
whoami File 34136 bytes December 18 2025 13:54:40.
word-list-compress File 12280 bytes April 18 2022 15:10:53.
x86_64-redhat-linux-c++ File 1266616 bytes August 26 2025 09:47:24.
x86_64-redhat-linux-g++ File 1266616 bytes August 26 2025 09:47:24.
x86_64-redhat-linux-gcc File 1266576 bytes August 26 2025 09:47:26.
x86_64-redhat-linux-gcc-8 File 1266576 bytes August 26 2025 09:47:26.
xargs File 75888 bytes December 18 2025 14:57:01.
xmlcatalog File 20864 bytes August 06 2025 13:59:35.
xmllint File 75128 bytes August 06 2025 13:59:35.
xmlwf File 37848 bytes November 20 2025 07:31:32.
xsltproc File 29152 bytes August 26 2025 08:55:17.
xsubpp File 5080 bytes October 13 2019 08:58:35.
xxd File 21032 bytes October 12 2025 00:23:15.
yes File 34168 bytes December 18 2025 13:54:40.
zcat File 1983 bytes April 27 2022 05:49:28.
zcmp File 1677 bytes April 27 2022 05:49:28.
zdiff File 5879 bytes April 27 2022 05:49:28.
zegrep File 29 bytes April 27 2022 05:49:28.
zfgrep File 29 bytes April 27 2022 05:49:28.
zforce File 2080 bytes April 27 2022 05:49:28.
zgrep File 7582 bytes April 27 2022 05:49:28.
zip File 234496 bytes October 11 2019 13:11:04.
zipcloak File 105376 bytes October 11 2019 13:11:04.
zipgrep File 2953 bytes October 10 2008 17:40:36.
zipinfo File 206728 bytes June 03 2025 02:10:12.
zipnote File 100104 bytes October 11 2019 13:11:04.
zipsplit File 100104 bytes October 11 2019 13:11:04.
zless File 2205 bytes April 27 2022 05:49:28.
zmore File 1841 bytes April 27 2022 05:49:28.
znew File 4552 bytes April 27 2022 05:49:28.
zsoelim File 43576 bytes October 13 2019 14:29:41.

Reading File: //usr//bin/cmp

ELF>�0@H�@8
@@@@00pppХХ �� � ,x0 ���� �� �����  ���DDP�tdԖԖԖ44Q�tdR�td�� � /lib64/ld-linux-x86-64.so.2GNU�GNUGNU:��{(byĐ��d����-5EMA EFK)��Pv������,cr�bA�9�2����Z|�p�� v�I���IDE9��W�"�1+�w��#�We�T�^� =5��Kb��h�N=Cw� �R1"n
'(� � � |!@� �@� �! � �`� *0� �8� libc.so.6__printf_chksetlocalembrtowcoptindstrrchrdcgettexterrorputsiswspace__stack_chk_failreallocabort_exitprogram_invocation_namestrdup__assert_failiswalnum__ctype_get_mb_cur_maxcallocstrlenungetcsigemptysetmemset__errno_locationreadmemcmp__fprintf_chkstdoutstrnlenlseeksigaltstackmemcpyfclosemallocmbsinit__uflownl_langinfo__ctype_b_locgetenvoptargstderrwcwidthfscanfgetopt_long__fxstatfwriteiconv_closesigactionstrchriswcntrliconvprogram_invocation_short_namefdopeniconv_open__cxa_finalize__sprintf_chk__xstatmemmovebindtextdomainrawmemchrstrcmp__libc_start_main__strtoul_internalfputs_unlockedfree__progname__progname_fullGLIBC_2.3GLIBC_2.3.4GLIBC_2.14GLIBC_2.4GLIBC_2.2.5_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableii
�ti	�����ii
�ui	�� `1��  1� �  � �(� ��0� ȋ8� P�@� ��H� ،P� �X� H��� ���� ���� ͎� ܎� �� � �@� �`� ��� ��� ˏȯ Я !د (� =� A � F(� E0� K8� L@� H`� Jȭ Э ح � � � �� � 	� 
� �  � 
(� 0� 8� @� H� P� X� `� h� p� x� �� �� �� �� �� �� �� ��  �� "Ȯ #Ю $خ %� &� '� )�� *� +� ,� -� . � /(� 00� 18� 2@� 3H� 4P� 5X� 6`� 7h� 8p� 9x� :�� ;�� <�� >�� ?�� @�� A�� B�� C�� D��H��H�!� H��t��H����5� �%� ��h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?�������%ݑ D���%Ց D���%͑ D���%ő D���%�� D���%�� D���%�� D���%�� D���%�� D���%�� D���%�� D���%�� D���%}� D���%u� D���%m� D���%e� D���%]� D���%U� D���%M� D���%E� D���%=� D���%5� D���%-� D���%%� D���%� D���%� D���%
� D���%� D���%�� D���%�� D���%� D���%� D���%ݐ D���%Ր D���%͐ D���%Ő D���%�� D���%�� D���%�� D���%�� D���%�� D���%�� D���%�� D���%�� D���%}� D���%u� D���%m� D���%e� D���%]� D���%U� D���%M� D���%E� D���%=� D���%5� D���%-� D���%%� D���%� D���%� D���%
� D���%� D���%�� D���%�� D���%� D���%� D�+����&����!��������������AWAVL�5q� AUL�-nATLc�UH��SH��nH���H�>dH�%(H��$�1��ȏ �H�5�m��j���H�5:mH�=�m�7���H�=�m����1���H�D$hI��E1�L��L��H��D���X����������b����Hc�H�>��H�j� �H�5�g1������H�-4mH��H��1�����H�5�g1����H���;����H�5�g1����H�5�l�H��1����H�� �1�H�5�g�h���H��H��� H���v���H�5�f��1�H���8���H��H��1��F���H�3H��u�1��H�5�g����1��H�5hH�����1��H�5?hH������I��H�ٿH��H�51l1�����~.�9�UH�=�k�;H�5�kH�=�kH���H�=�� I��H�5�kQH�
̍ I��H��kj1��I-^_��1�H��$�dH3%(��H���[]A\A]A^A_ú:1�H�5�� �4H��� H�PH��� �8:��H�� H9� ����H�֍ ������ ���H�=N� 1�1�L��L��l�s1���TH�D$hH;�� �}���H�� �q����=j� ��Z� �U����O� ��t	�����8� �3���1�H�5Ό ��\����A�Nj�� D9��oHcȍPH�4�H�L���� H�
e� H�
�lD9���Hcn� H�
O� A9�~b�PH�\$hH�D�1��M� H��1�H�D$h��
Hc7� D9�}2�PH�D�H�޿�� 1�H�D$h�
Hc	� D9���1�L�%lL�-�� L�5э L��1�L���������1��tH�B� H93� �Hc�H��� L��L�4�L��������'H�
e� ��HiӐ�ƿL�������O	�����D$TH��� H9
� �� ����%�=`�J= ��=�� �U�� %�=�u�_� %�=��fH�=؋ H�5a� H���������:4H�XH�O� H��H��H��H���+�=� �D$@I��H�2� H�H�$H�+� H�d� H�D$��E1�H�� N�,�M���rI���]H��$��D$SH�D$H��$��D$8H�D$H�D$0H�D$ D�|$DH�D$H�-�� H���tH9�HG�H)�H�D$H�ʋ H��L���8�2H��H����
H�4$�=�� H���~2I��H�����	H9�H��H�4$L��HF�H���H����� L�l$��������Hl$H��tkI���tdK�>L�|$HL��E1��H�D$(I���
�L$S�I��H�x�
�
���I9�u�H�D$(�L$SL�|$HLl$0�I9��C�|>�
�D$SL9��BH;�� ���1ۃ|$8�Ë=Ŋ �`��������=�� �M���������t
�=.� ���������������H�L5��� �+���H�ى I9E�F���;� �W���H�̉ H95� �C����ʼn 9/� �1������ 9!� ����H��� H9� ����H�ȉ H91� �����H�ĉ H9-� ���1��H
�H���;
H9����������?� %�=`���=4� ����H�T$p���&������D�=� ������}���1�1���H�<$L����D$(��A�C�&��B�'H�H9�51�L�D�H��D:D�t�M)�LT$M��M��t�������L9���������������|���������A����D���0	H���|���D�d$�	I)��l���L9-O� L��H��� L��HF-:� B�<�H���^/H9�t�H��Hcl$�0�����H�
n� �H��c�0H��1��e���1�1�L��1��g���H�
0� ���������=�� �'��N���H�� L��H�8����g����M���H�|$H��$��H�|$0H��$�H����=S� I�����H�5Le1��e�H��H�;eH9���H�
�� H��� M��I��H��1��O����L9�������D$8����H��$�H�\$HL��H�D$8L�d$X�*�T$@H��E��H�5�c1���H��H9���H�$E�<J�<+D�$E8�t�H�t$�
�=x� E��t�H�|$ D��H�D$(D�D$�L�|$8D��L���yAW�H�5-cATH�D$8L�L$0D�D$�T$PH��1��l�XZ�j���J�D-H�\$HL�d$XH�D$�D$D�D$8�y���H��������H��HI�E� %�=������ %�=����D$@�
H��H�H��H��������D$@��H��H������w� %�= �8���H�p� H9ل �����g���H�$L��$�L��B�,8G�<>L��$�D���]��L���SH�
�� 1�H��� �H�5G^H�L$H�$�)�AVM��I��UH�ƿ1�AUAWH�L$(H�T$ �#�H�� �]���H��$H�5�a��a�������H��$H9D$x���$�%�=`�= �f�����$%�= �O���H��$(H9�$��9����A� �*������
���H�7� ��H)�H9�HO��W���H��� 1���H)�H9�HO��$���H�-j� H�������H�=� �|���1��H�Ճ �H)��1�H��HH�H)�H��HH�H9��E���HO�H;	� �4�����1���H�
�� �H�m_�0H��1�����"���(���H�
˃ H��� H�-%a�����=-� �����1�L9�H�
�� ��H�|$H���'H�|$H��$�H����=� H�����D$SH�|$0H��$�H)�I�����I��E����H�5A\1����H�=k� H��M��I��H�پ1��S�����H��$H9D$p����������$%�=`�A������1�H�=Y���H�5؀ H�=R^�H�5�[1��F��o���1��H�5
_�.�I��H�پH�=�� H��1����p����H�5I[1���H�=�� H�پH��1���|��L���H�t�H�=c^�vJ�t�H�=7^�e�D$T��HcT$T�H�
� �01�H��H�\]������H�
ρ �H�?]�01������H�
�� �H�]�01������1�I��^H��H���PTL�WH�
�VH�=X��" �H�=i H�b H9�tH��~ H��t	�����H�=9 H�52 H)�H��H��H��?H�H�tH��~ H��t��fD�����== u+UH�=�~ H��tH�=�x �Y��d���� ]������w����SH��t#H��H��1��8�H��1�1�H��1���H��� �H�5V1��
�1��H��H��1��Y�f�AUL��]A��1�ATUH��S��H��L�&dH�%(H�D$1�H��L���g"��t��uDH�ED8(u;H�$H��x2H�u~ Hc�H;�wH�D$dH3%(u!H��[]A\A]ÐH����L��H�=�U������fDSH�~ Hc߀<tH��} H��[�f��H�~ �H�4�H�U �<���H��} H��[�ATA��U��SH�����@�͉�H��DH@u@��x"A��w3�^A�T$@H����C[]A\�D�M-D�e�H��f�C�A��v�D��A��u��^�?H����f.�H�=�| S� u�N���u-[úH�5#Z1��U�H�"Z1��H��1����H�5Z1��*�H����H�ٿH��Y�01��j�f.���Ðf.���U1�SH��H�M� ��H�4� �_H��H�����H��H���t���H�5�[�^�H����H�޿H���F���H�5�Y�0��=�{ ���D��S1�H��H��dH�%(H��$�1�H��H��} �D$H�$H�D$ �����u~H��H�
����HD�H�5[1�H�a� H�\$ ����H�5�Z1�H�:� ���H�|$(H�!� ��1�H�޿H�����DŽ$��H�D$ �6�H��$�dH3%(u	H��[���D��H��z �@��H��1��a�H�¸H��t�H�=gZH�������1���uH���f��H�=EZH���������H�����H�N�FA�0H���������I�gfffffffH��x8DH��H��H��H��H��H�H)ǃ�0@�9H��H��u�H���fDH��H��H�q�I��H��H��?H��H)�H��A�@)�H�׈A�H��u�H���F�-H���@��SH��tw�/H����H��tUL�@L��H)�H��~EH�p��H�=�Y��€���u)�H�=�YL��L����€���uH�XH�Oy H�`� H�ay [�H�
xy �7�H�=�X�R��
�f.�PXH�
�Y��H�5YH�=YH�����f.�AWI��H���AVAUATL�%&_USH��dH�%(H��$�1�H�\$ H�l$`�
L�s$H�D$f�A�?��H�t$L���5I��H��tu��H����H�|$��I�TM9�sH�T$���A�M�H�T$H��Hu D�:E������H�B�x��A�}tM�}A�?�v����D$H�|$����D$H��$�dH3%(��H�ĸ[]A\A]A^A_��L�|$0�D$ H�C�D$,M9�rp�w�L�|$0A������A������H�D$8A��D$@�T$D�D$,����L�|$0L|$8�D$@�D$,L�|$0M9���|$ t����L�|$0H��L��� H�KL��L��H���� H�D$8H�����H�����H����H�D$8L�|$0A�?���T$D����H�{�T$�D$@���T$��t�D$ �D$,�9����H�{������?�D$ �H���D�T$DL�|$0�D$@H�D$8����@L�|$0L�����D$@�T$DH�D$8������T$D�_�����������A����D$H�D$L�l$0�D$ H�C�D$,H�D$p�D$`H�E�D$l��f�H�T$p�
�����A������H�D$x�Ƅ$���$���$��D$l����|$,���|$ ��H�T$0�
�����A������H�D$8��D$@�D$D�D$,�|$D�����H�D$8HD$0H�D$xHD$p�D$,�D$l�|$`�0�����L�|$pH��L����H�MH�}$L��H���H�D$xH����H����GH��u&H�D$xH�D$p�8�z��$�����H�}Ƅ$������t�D$`��$��D$l������|$,���|$ �@H�T$0�
�����A�����H�D$8��D$@�T$D�D$,��t�|$@t���6���u�|$��L�l$0L�{�D$ H�C�D$,A�M�����A�����IH�D$8A�E�D$@�D$D�D$,�D$D�������L�|$8M����@H�{������/�D$ �
�L�|$0H��L���]H�KL��L��H���H�D$8H�����H�����H��u%H�D$8H�D$0�8��D�D$DE����H�{�D$@�J���t�D$ �D$,�����|$@��������H�}�����w�D$`���DH�D$xƄ$��D$l����DH�D$8�D$@�T���DH�|$p���Ƅ$�H�D$x�D$l�����H�|$0����D$@H�D$8������D$����H�{�m������D$ ���L�D$0H��L��L�D$�L�D$H�KL��H��L���H�D$8H�����H����RH����T$DH�{�T$�D$@���T$��t�D$ �D$,�x����|$@�T$D�m����d���@L������� �D$ ���L�D$0H��L��L�D$�IL�D$L��L��H��L���H�D$8H���tkH�����H��uH�D$8H�D$0�8���T$D��ujH�{�D$@�<���t�D$ �D$,�4���H�D$8�T$D�D$@�D$,���H�D$8����H�D$8H�D$0�8us�T$D�������k���H�|$0�.��H�D$8����H�|$0����D$@�T$DH�D$8�D$,�>����D$�A���H�
�P��H�5APH�=VP�I��H�
�P��H�5"PH�=NP�*��H�
sP��H�5PH�=P������fD��ATH���UH��1�S�V��H��H9�tH��H��������tH��[]A\��H���H��H��I���=��I�|�cI��I�ؾI��H��1�H�����L��H�
�O���H��[]A\�f���AW�AVAUATI��USH��H��1�H�����H����H�5xOH��I���o���L��H������H��twI��I��E1����FL��H�������u/H�D$M��tYL��H��������tJH�|$t
H�|$�x��M��tL���k��H��H��[]A\A]A^A_�f�����L����M��tL��H���p�����u�H�����H��I�����I�|�I��I��H��I��1�H�����H�
tN���H�D$H��tH������L���W����L��H�5LNH���L��I�����H�xI���L��L��H�����H��H�5NH��I�H�//TRANSLI��ITH��fA�GA�G
H�L$�H�L$H��H���H��H�����?H���R��H��tMH���%��L��H��M�����!������L��H���>�L�l$���L��E1�E1��E���L��H������M��������I9�t?H��L������D����L��H�����M��u�E1�E1�L������f.�L���
����H������L��H��������H�D$E1�L���
���f��;��E1�E1�L���_���DI��I���O���L��H���B��uI��I��L�l$L���M���E1��Y���I��L�l$�T���fD��UH��H��SH��1�H���f��H��H)�H��H��H��HE�H��[]�f.��PXH�
GL��H�5.LH�=�KH������f.���AWAVAUATA��USH��hdH�%(H�D$X1����H����H�����H����E����H�\$(H�ڋ
H����������!�%����t��D$I������H�D$D�H�J�D$$HD�H�$��@�H��E1�I��H�T$H9��H�l$H�EH�D$�5�|$8A�t�|$<E1��w����A��L�t$(�D$$M9����|$��A�H�5�P�����������H�D$0A�L�d$(L�l$�D$8�D$<M�t$�D$$E���p���A���.A���t�|$8�i�|$<����L�t$(����D$$DD�M9��\���f.�A����fDH�t$XdH34%(H���H��h[]A\A]A^A_�f.�H�|$��������D$L��H�MH�},L��L)��CI��H�D$0H����qL�d$(H�����H��u&H�D$0A�<$���D$<����A�H�}�D$8M��f��L�l$�������D$�����|$8�L����|$<�����LD$$�DE�L�$$�*���E��tY�+@����2��I��H��f.�I��A�m@��t�Dh u�L���3��L��H��H�P�T��A�������H�ڋ
H����������!�%����t������D�H�JHDщ�@�H��H�j�H9��U������H���EH��H9��7����E�DB u��'����L�d$(L�l$�D$8H�D$0M�t$���fDL�t$�D$8L��M��L)�H�D$0�m���A����DH�\$(H�ڋ
H����������!�%����t�L�l$�D$H�������D$$L�5�MH�D$D�H�JM�}HDщ�@�H��H�T$H9�ws�>fD�M�����A������H�D$0�E�D$8H�l$(�D$<�D$$�|$<�������H�T$Hl$0�D$$H�l$(H9����|$t�I�MH)�I�},H���nH�D$0H�����H�l$(H�����H��uH�D$0�}���T$<����I�}�D$8�����t�D$�D$$�U���H�$��\���@L��H�$�l��H�$�����D$�U���fDH�D$0H�l$(�D$8�D$$H�����H��H��H�P���A����������f�H�D$�D$8�D$$H)�H�D$0�I�������Z���	H�
F��H�5FH�=�E������H�
�E��H�5�EH�=E�r��f���AWAVAUATM��UH��SL��H��(H����I��I��H��1�H��E��@��1��H�5�E���A���H��H��H��H1����1��H�5F�[��H��H���p��I��	�&H�oHJc�H�>��DI�ȾH��1�H�:E����r���f�L�K8H�C�1�L�CH�5GL�k0L�c(L�{ L�L$L�sH�H�$L�D$����H��L�L$H��H��H��1�AQAUATAWAVL�L$0L�D$8�>��H��0H��([]A\A]A^A_�L�S@L�K8�H�5�FH�CL�CL�k0L�c(L�T$L�{ L�sL�L$H�$H�L�D$1��?��L�T$AR�g���H��H�5JD1����H��(H��H��H��[1�]A\A]A^A_����L�c�H�1�H�5D����H��(M��H��H��[H��]1�A\A]A^A_�P��L�kL�c�1�H�H�5�C���H��(M��M��H��H��[H��]1�A\A]A^A_�	��f��1�L�sL�kH�5�DL�cH��>��H��AVH��M��M��H��H��1����XZH��([]A\A]A^A_�@L�{ �1�L�sH�5�DL�kL�cH�����AW�fDL�CL�c(�1�L�{ L�sH�5�DL�$L�kH����H��M��ATAWAVL�D$ H��H��H��1��#��H�� H��([]A\A]A^A_�L�KL�k0�1�L�c(L�{ H�5BDL�sL�CL�L$H�L�$�9��AUATAWAVL�L$(�f.�L�S@L�K8�H�5�DH�CL�CL�k0L�c(L�T$L�{ L�sL�L$H�$H�L�D$���f���E1�I�8tI��K�<�u�������H��hE1�dH�%(H�D$X1�I���#A�ƒ�MPA�I�K��H��t/I��I��
t%A���/v�M�PI�BI�@I�K��H��u�DM���`���H�D$XdH3%(uH��h��V��fD��UA� S1�H��L��$�L��$�L�D$ L��$�E1�dH�%(H�D$x1�H��$��D$ H�D$H��$�H�D$H���)@D�лA��H�H�K��H��t%I��I��
tA��/v�L��I��H�K��H��u�f���tD�T$���H�D$xdH3%(u
H�ĸ[]��s����S�H�5�@1��(��H��@�H��1��2���H�5�@1����H�
�B�H�5=H��1����H�C_ 1�H�5�B�����H��[H������f.�f���SH���S��H��uH��u[��rf���H��H��H����H��x
��H��u�P�K�f.����f.���SH��H��uH��uH���&��H��uH��u[�f.��[��1�[���f���H��H��H����H��x
��H��u�P���f.���I��H�H��t1H�TUUUUUUU1�I��H9�v8H��H��H�LH�I��H���S���H��t#H��I������H��xH��t�P�_�1Ҹ�E1�I��I���A��I��f.���H�H��t,H�SUUUUUUUH9�w7H��H��H�DH�H�������H��u��H�H�����y�P�����SH���3���H��1�H�����[�@��H��H��H����H��x��H��u����H��tH����~@f.���UH��H��SH��H������H��H��H������H��[]���UH��SH���n��H�XH�����H��H��H�����H��[]�f.���PX�H�5�@1�H������=U\ H��91�H��1��J���5��D��S�)�Å�x��[�@�#���8u����f���S�,H��H��tH��[�f������8u��a������S��.H��H��tH��[�f�����8u��1������AWAVAUATUSH��(dH�%(H�D$1���$�I��H��H�D$H���$I��M��LD��e���I���]�����$H�0H����H�����DN u�-tl1�L��H���]��M�H��I9�tbA�$��uB1�M��t
E� E���vI�H�|$dH3<%(���-H��([]A\A]A^A_�fD���"t�����L�$M��t�D�eE��t�A��L��1����L�$H��t�A�T$���/wgH�E�0D��$H��sT�0L��L�D$�R��L�D$H��t8A�@<D�S<i�Z<B�$�?H�
�>Hc�H�>��fD��A��BA��5��H�
)?E��Jc�H�>���Hc�H��H��p=H��p8H��fDHc���I��M�A�8E������H��H��H��qѽH����fDA��L��L�$�p��L�$H�����I����e���H��x�H�뎾H��H��7u�H��	�w�����HcʿE1�f�H��H��H������u�D	��D�����HcʿE1��H��H��H���.��u��ƾ�HcʿE1�DH��H��H���Y��u�떾�HcʿE1�DH��H��H������u��c�����HcʿE1�f.�H��H��H������u��+�����Hc�H��H��pbH��p]H��pXH��1�	��L���H��H��6�n���H��
�6�����,���@�������1�A�xB�@�ƍt6����H��	����{��A�H������A�H���L���A�H������A�H���^���H�
x=�`H�5�;H�=�;���A�H��������AWI��������AVI��AUA��ATL�$USH��H���
DH�L9�s@L��H��D��H)�L9�IG�H�����H���t�����8u,H�����v#A����L9�r�H��H��L)�[]A\A]A^A_�H��H�����[]A\A]A^A_�f.���I��H��tDH��t6H��H��1�H��H��u?H��1�H��H��H��I��L9�w1�H��H��L9�HD�H���DH��� HE�H���H��H������AUI��ATI��USH��H��dH�%(H�D$1�H��H�D$HD�H������H��H���vM��u'H�T$dH3%(H��u-H��[]A\A]�f�1�������u�A�E����b��f���1�H9�tM1��	�H��8�u5D�A�H�D����wA�� �� D�E�Q�D��A��wA�� �� ��u�A��E��D)�����AW�AVAUATUSH��dH�%(H��$�1��^��L�=w H��H��H��2HD�M��u#�@L�����I�lH�����L�|A�/@��t)L��H�������t
@��*u�A�u�L���Q���I�\�;H��:HD�H��$�dH3%(H����H�Ĩ[]A\A]A^A_�f�H�=u:����I��H��tE�8t@H�����I��I��H������f��H��H����L�=2L�=v �9����A�A�
L�-:�*��H��H��t�L��L��H������B�D5/I�H��H�charset.I�$�sfA�D$1�A�D$alia���A�ą�y$L�=|1H���T����l���L��L��H���q����H�53����H�D$H���
L�t$ L�d$`H�l$H�\$L��L��I��f�I�FI;F�vH�PI�V�8�G���v߃� tڃ�#��L���Y���1�H��H��H�59L���2������@I��A�UI����������!�%����t��I������D�I�ULD��I��I)�A�$I����������!�%����t������D�I�T$LD��I��I)�H�|$K�D%�"H�HH�xH�L$�}���H���)H�L$H�����L)�I��L)�H�H�A���A����E��t�u@�2A���	I��H�T�A���!A����E��t��
A����I��I�FI;F�����L���T����ǃ�������L��H�l$H�\$���H�D$H�����A�����H�PI�V����
������I�FI;Fr�L������������HD$L��H�HH�pH�L$蓿������H�uH�2D��H�|5�H�|2�H�rH��H��H)�A�H)�A��A�����A��1�A�Ѓ�N�N�D9�r�����H�H��H�
D��H�t�H�t
�H�rH��H)�A�H)�A��A������A��1҉у�L�L�D9�r������������*���A�|�/��H�x����D��譽������uE��2B�t-�B�t*��3����E��
B�L#�B�L"��N���L��H�l$H�\$L�=�-�»��L���Z����Y���E��B�t-�fB�t*����D���t�f�t
�����H�xI�������m���f.���S��贽����x[�fD�����[����������UH��SH��H�CH��H�6H�SH9�t H�7�CH�U�E��t�C�EH��[]ÐH�OH���$���H�SH�E��f.�����H�S5������������f�UH��SH��H��H��8dH�%(H�E�1�H��H��=��H��xh��H��u`H���w^H��'I��H��H���I)�H���L��H9�tH��H��$�H9�u�%�t	H)�H�L�H�|$H���H��H��u,1��H�M�H�U�H�u��"H�M�H�U�H��H�u�H��t�H�GE1�A�H��vB�B�D�B:u��N+�B8��M��u�N��E1�I��L9�u�H�D�I��1�DE��tD8t5H��tPL��L�L)�E��u���!�H�M�dH3%(uPH�]���f�H��M�QH9�t6E�AM���f�E�AH��I��두I��L��L)�J���_���H����PXH�
�3��H�5'-H�=*-H���+����f.�UH��AWAVAUATSH��H��H����H��H�����dH�%(H�E�1��!�8H��H���H��H����H��x{��H��usH���H�<�H)�H��H���wxH��'H��H��H���H)�H���H9�tH��H��$�H9�u�%�t	H)�H�L�L�l$I���I��M��u11�H�]�dH3%(�7	H�e�[A\A]A^A_]���I��M��t�H���M��H�����H�����ƅ���A�L�4@H�CHDž���I��ƅ���M�H�����f�H�����H�5�1�
�����������HDž����D�� �����$���D��$���D�����E���
�H�����H�K(H�����H9���I�7I�WA�G��t
��$���A�GH����I��0ƅ���������P���苷��L�����H��L��L����������L������H�KH�{$H��L����H�����H����OH����eH��u+H�����HDž����8�ZD��$���E���iH�{D�� ���譹����tƅ���D��$���D�����E����E1�M�}0H���I�FHDž������A�_�%f��xt%�@A9Gt5M���(O+$�K�dH��L��u�I�WH;Pu�H�0I�?�`�����u�H������I��H��L)�I��H������I��0H������H9���w���H�����H�]�ƅ@���E1�H������H��L��@���H�H����HDžD���ƅL����E�H�E��E�H����H��P���H�E�1�@�����}���K�H��L�H�PH;U���M������L����G��@����kH��P���H�/�
����������,HDžX����ƅ`�����d���ƅL�����d������.���H��X���H�P���H�E�HE�ƅL����E��}��QH�U�H��.�
����������H�E���E��E��E��U���tLK�H��L�x�����9P�����H�E�I��HE��E�L9���{���H��P���H�����H�L�������H����������RD���������I�OH���t���H�����I��� ����9���fDHDž���1�ƅ ���D��������H������ܳ��ƅ ���H�����1�D���������H�����T��������E�蓳��H�]�H��H������H������H��H�NH�~$H����H�E�H����,H����H��u H�E�H�E��8�u�E�����H�������E�H�x�ɵ����t�E��E��X����H�u�H�8�����a���M���_���K��L��H)�H�����E�H���
�����L���t(��`���ulH��X���ƅL���H�P���H���T��@���utH��P���H�5-,�
���������t9HDžX����ƅ`�����d���ƅL�����d�����u��R����I�|$�ִ�����<ƅ@�������L��P���H��L���`��I�L$I�|$$L��H����H��X���H���t^H���txH��u)H��P���HDžX����8����d������I�|$ƅ`����I�����tƅ@���ƅL����;���f�HDžX���ƅ`������f�H��P����d���ƅ`���H��X��������E�L�����x���H�E��E��E��u���I�|$辳�����$ƅ@������H��P���H��H���H��I�L$I�|$$H��H����H��X���H�����H�����H��u)H��P���HDžX����8����d�������I�|$ƅ`����)�����tƅ@���ƅL����@���f�H������I���	���H�}��W����E�H�E��E����fD��`����������fDHDžX���ƅ`������H��P�������ƅ`���H��X�������H�
�)��H�5;#H�=P#�C���H�
�)��H�5#H�=H#�$�������H�
h)��H�5�"H�=�"����蛯���f.���AWAVAUATI��USH��H��H�t$dH�%(H��$�1��8���H����H�D$D�8L��E���DA�4$@���H�\$HH�L$E1�1�1�H�\$�hfDH��t#H��H��H�L$H)�H��药��H�L$H��9uxL�d$L���î��H�L$L��L��H�������1�fDA�6M��H��I��H�ZM�t$D8���A�|$�tI��	�� �A��t�K�D�H9��`���D���H��L�-�'H�\$`H�\$P��D$PH�kH�D$T���D$\����A�D����SH�D$h�L$t�D$p�D$\�D$t����L��H��$�dH3%(��H�Ĩ[]A\A]A^A_�@L�T$A�r@��t�A�>@����H�Z@8�����H��M�L���<@���sH��@8���A�4@��u��o���H�D$h�D$p�D$\H�D$Ƅ$�1�H��$PƄ$�L��$H��$�H�D$HHDŽ$�L��$�Ƅ$�HDŽ$�Ƅ$�H�D$H�D$(�D$H�D$0@H��$���$�I����H��$��
�����A�D�����HDŽ$��Ƅ$���$�Ƅ$�D��$�E���NH�|$	��"D$��H�t$H��H9����D$H���|$p���D$t9�$��fo�$�L�Efo�$�Ƅ$Pfo�$�H�E)�$ H��$(fo�$H�$ H�D$)�$�H��$`)�$0��)�$@��Ƅ$��Ƅ$\A�D�����HDŽ$h��$tƄ$pƄ$\��$t���C���H��$hƄ$\H��H�$`�$H��$`�
�����A�D����>HDŽ$h�Ƅ$p��$t��$tƄ$\������$����$��H��$ �
�����A�D�����HDŽ$(�Ƅ$0��$4Ƅ$��$4���F��$p�49�$t��H�S���4H��$(H�$ H��H��$hH�$`Ƅ$Ƅ$\��$P�����̩��L��$`H��L�����H�MH�}$L��H�����H��$hH�����H�����H��u,H��$`HDŽ$h�8�Q
��$t���*H�}Ƅ$p�����tƄ$P��$tƄ$\���|���H��$��C����HDŽ$(Ƅ$0Ƅ$H��$(H;�$h�H��$�H�$�Ƅ$�H�D$����I�~�_������l	Ƅ$蚨��L��$ H��L������I�NI�~$L��H����H��$(H����R���H�����H��u,H��$ HDŽ$(�8�	��$4����I�~Ƅ$0�ƪ����tƄ$��$4Ƅ$�������1�����f���$0�������DH��$`H��$ 賨���������f�H�}�G������TƄ$P���f�HDŽ$�Ƅ$�Ƅ$�H�|$	��"D$��H�t$H��H9����D$H��H��$�H;L$h�N���H�t$`H��$�H��H�L$ �
���H�L$ ���'��������HDŽ$hƄ$pƄ$\�&����H��$�H��$�I���`������mƄ$�蛦��L��$�H��L��L�D$ ����L�D$ I�OI�$H��L����H��$�H�������H����H��u,H��$�HDŽ$��8���$�����L��Ƅ$�H��躨����tƄ$�Ƅ$�����H��$`��Ƅ$pH��$hƄ$\����fDH��$ �å��Ƅ$0H��$(Ƅ$���fDH���v����H���@����H��H+t$(��$�I�����t2��$�u~H��$�H�$�L��H��Ƅ$�I�����$���H��$��
�����A�D����9HDŽ$��Ƅ$���$�Ƅ$�D��$�E���q�����$���H�T$0H�t$L�����D$������$����H��$�H�D$�n���L��$�H��L��L�D$ ���H�t$L�D$ H��H�NH�~$L���i�H��$�H�����H�����H��u.H��$�HDŽ$��8��D��$�E����H�|$Ƅ$�H��脦����tƄ$�Ƅ$���H��$�H��$�H�D$�N������[Ƅ$�����f�HDŽ$�Ƅ$������H��$��c���Ƅ$�H��$����fDH��$��;���Ƅ$�H��$�Ƅ$����fD��$��=H��$��
�����A�D�����HDŽ$��Ƅ$���$�Ƅ$�D��$�E��������D$��$�H�CH�\$(H�Ä��o����D���L��L�D$8�������(Ƅ$P�V���L��$`H��L��L�L$ ���L�D$8L�L$ H�}$H��L��L���R��H��$hH����H����'H��u,H��$`HDŽ$h�8����$t����H�}Ƅ$p�t�����tƄ$PƄ$\�x���H���P������]�D$P莡��L�t$`H��L������H�{$H��L��H�����H�D$hH�����H�����H��u.H�D$hH�D$`�8� �D$t��t�Z�f.�H�{�D$p�£����t�D$P�D$\���HDŽ$hƄ$p���H��$`���Ƅ$pH��$h���H��$�H�D$諠��L��$�H��L��L�D$ ����H�t$L�D$ H��H�NH�~$L�����H��$�H�����H�����H��u.H��$�HDŽ$��8�!D��$�E�������H�|$Ƅ$�H�������tƄ$�Ƅ$��F���H��$�H��$�H�D$莢������Ƅ$�����H��$��̟��Ƅ$�H��$�Ƅ$����H�D$H��H�|$`蛟���D$pH�D$h�D$\�C�HDŽ$�Ƅ$�Ƅ$�������F�����$���������H�
��H�5�H�=�蜟���7���H�
���H�5pH�=��x������AWAVAUATUSH��H�$H��h1�H�|$(I��H��I��H�L$1�1�1�L�D$ L��E1�L�t$HL�l$@dH�%(H��$X1����H�\$0H�\$PL�|$8M��tyH�D$8H�t$0L�|$H�t$I���DH�D$@H)�H�H�|$8��H�t$M��L��L��L��H�\$@H�D$H荝��H���u��b������t�L�|$����1�1�M��L��L��H�\$@H�D$H�M���H����VH�D$@H)�H�H�D$�MH�D$H�H�D$H���H�D$ H�T$H9��E1�1�1�1�L��H�l$8H�\$0���H�D$(L�|$8H�D$0H�D$H�D$@H�D$H�D$H�'@M��L��H��H��L��謜��H�����L�|$8M��u�1�1�M��L��L��膜��H�����H�|$H�$���H�D$H�t$1�H�|$H�0H�D$ H�8H��$XdH3%(����H��h[]A\A]A^A_�f�L�|$���fDH�|$�6���H�D$H�����ӛ���������fDH�D$ 1�H��y���D裛���8�"���H�D$�����L�t$L90�N����}���L��D� H���O���D�e�2����1������AWAVAUATI��USH��XdH�%(H�D$H1�H�|$(��I��H�D$0I��H=LC�I�mH���_���H��H����E1�1�1�1�L������H�D$@H�\$8H�D$H�D$8H�$H�D$0H�D$H�D$(L�l$@H�D$�k�賚��I�Nj�������2L�t$8L�l-I)�L9��NL��H������H���:J�40H��L��H�t$8I�u�H��L)�H�T$@L�D$H�$L��H�T$H�t$�Y���H����w����kD�#����8H����L�|$8H�T-I)�H9���H��H��H�T$H�D$�|���H�T$H�L$H��tmJ�8H��H��H�L$8H�J�L)�H�L$@L�D$H�$1�1�L���͙��H����{���H�D$8H�PH�T$8�H�t$8H)�H9�v%H���
���H��HE��@�H��1��@���H�|$HdH3<%(H��u2H��X[]A\A]A^A_�fDA�����#��������fD��AUATUSH��H���?tI��H��H��L���Y����u%H���-���H��H��teH��H��[]A\A]��H��L���U���H��H���t\H��H���A���H��H��tYH���a�����y�舘��H��1�D� H���X���D�e�f��k����H��H��[]A\A]��1��t���f��;���H��D�(I�����E�,$�O���@��H��r_H���]���1�H��H��tDH�H�@J�H�����H��H��H��H��H��H�H��H)�H��H�
N H�<�H��H�>H��H���1�H��Ð��H��t	��J�t�DH�����H��H��H��H��H��H�H��H)�H��H��M H��H��t�H9�u�6f.�H9�tH��H�A�H��u��DH��H�G�H��H�����H����f.�@��AVAUATUSH��H��PdH�%(H�D$H1�蘗��H��w2H��蚗��H��H�t$HdH34%(H����H��P[]A\A]A^�H��H�\$L�%1��$L�mH�D$�D$�^�H�T$�
�����A������H�D$��D$ �D$$�D$�D$$���e���H�D$HD$H���D$�<$t����L�t$H��L������H�MH�}$L��H������H�D$H���thH���tzH��u#H�D$H�D$�8���T$$����H�}�D$ ������t�$�D$�Z���f�L�������t=�$�h���H�D$�D$ �9���DH�|$�&����D$ H�D$����H�
���H�5`	H�=u	�h�������H�
���H�5<	H�=h	�D���H�
���H�5	H�= 	�%���D��AWI��AVI��AUA��ATL�%�" UH�-�" SL)�H���G���H��t1��L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.������H��H���Try '%s --help' for more information.invalid --ignore-initial value '%s'-b, --print-bytes          print differing bytesoptions -l and -s are incompatibleUsage: %s [OPTION]... FILE1 [FILE2 [SKIP1 [SKIP2]]]
Compare two files byte by byte.The optional SKIP1 and SKIP2 specify the number of bytes to skip
at the beginning of each file (zero by default).Mandatory arguments to long options are mandatory for short options too.
Exit status is 0 if inputs are the same, 1 if different, 2 if trouble.If a FILE is '-' or missing, read standard input.SKIP values may be followed by the following multiplicative suffixes:
kB 1000, K 1024, MB 1,000,000, M 1,048,576,
GB 1,000,000,000, G 1,073,741,824, and so on for T, P, E, Z, Y.%s %s differ: byte %s, line %s is %3o %s %3o %s
cmp: EOF on %s which is empty
cmp: EOF on %s after byte %s, line %s
cmp: EOF on %s after byte %s, in line %s
-i, --ignore-initial=SKIP         skip first SKIP bytes of both inputs-i, --ignore-initial=SKIP1:SKIP2  skip first SKIP1 bytes of FILE1 and
                                      first SKIP2 bytes of FILE2-l, --verbose              output byte numbers and differing byte values-n, --bytes=LIMIT          compare at most LIMIT bytes-s, --quiet, --silent      suppress all normal output    --help                 display this help and exit-v, --version              output version information and exitwrite failed%sstandard output/usr/share/localeinvalid --bytes value '%s'David MacKenzieTorbjörn GranlundTorbjorn GranlundGNU diffutilscmp
%s

  %s

%s

%s
%s
bci:ln:svmissing operand after '%s'extra operand '%s'/dev/null%*s %3o %3o
%*s %3o %-4s %3o %s
cmp: EOF on %s after byte %s
print-bytesprint-charsignore-initialverbosesilentquietversionhelpד��ד����������������������������������#�������������������������?�����������	���������������������������������������Ǒ��%s %s differ: char %s, line %s
%s %s differ: byte %s, line %s
kKMGTPEZY03.6: program errorstack overflowCPOSIXA NULL argv[0] was passed through an exec system call.
/.libs/lt-mbuiter.hiter->cur.wc == 0mbsinit (&iter->state)*iter->cur.ptr == '\0'%s (%s)UTF-8mbuiter_multi_nextmbiter.hmbiter_multi_next%s (%s) %s
%s %s
(C)Written by %s.
Written by %s and %s.
Written by %s, %s, and %s.

Report bugs to: %s
bug-diffutils@gnu.org%s home page: <%s>

License GPLv3+: GNU GPL version 3 or later <http://gnu.org/licenses/gpl.html>.
This is free software: you are free to change and redistribute it.
There is NO WARRANTY, to the extent permitted by law.

Written by %s, %s, %s,
and %s.
Written by %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
%s, %s, and %s.
Written by %s, %s, %s,
%s, %s, %s, and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, and %s.
Written by %s, %s, %s,
%s, %s, %s, %s,
%s, %s, and others.
http://www.gnu.org/software/diffutils/General help using GNU software: <http://www.gnu.org/gethelp/>
���������� ���p���ȹ������`�������H���Copyright %s %d Free Software Foundation, Inc.memory exhaustedxstrtol.c0 <= strtol_base && strtol_base <= 36��%��Q��%��%��%����%������%��%�����%��%��%�����%��%��%��%�����Q��%��%��%��%��%��%��%��:�����%��%��%��Q��%��%��%����%������%��%��%��%��%��%��������e���e���c��e������e���e���e���,���e�����e���e���0��e���e���e�����e���e���e���e����������e���e���e���e���e���e���e���������e���e���e������e���e���e���,���e�����e���e���e���e���e���e�����e���e���p���xstrtoumaxASCII/usr/lib64CHARSETALIASDIR%50s %50s���������mbuiter_multi_nextmbuiter_multi_next;0E����d�������D�������T���� ���p
,���`����L�����������������l���D����������� |���D����\��|�����<����l����|���X����\��������̭�� ���t����<����̸�������<���<\���X����l�����ܺ��������������������	\��� 	����H	̼��t	����	<����	l����	�����	��<
����
,���
����
�����\���|L���l���,���\�����h�����
<��
,�$��<<�T\����zRx�X���/D$4�~��FJw�?:*3$"\x���t�WA�8�8����B�N�A �D(�F@]
(A ABBB�����PA�\
Co(�̘��vB�D�C �v
ABF ���vH�O
A�0�F�B�I �I(�D0�D8�N�
�S�H�A�e
8A0A(B BBBA��N�^�A�#�G�L�B�S���������E�C�D  �d����E�L��
AA0���,(���`Hu
C_Lh����d��E�{
A�����%AA^H�����
	B�M�B �B(�H0�A8�G��
8A0A(B BBBH$zRx��������,����4(����F�I�F �`
ABHJABH`t���JF�G�B �B(�D0�A8�LP�
8D0A(B BBBJ$�x���5E�G�I ]AA�����%AA^P�����>F�B�B �B(�D0�A8�D��
8A0A(B BBBKD����F�B�B �B(�D0�D8�G`�hWpBxB�B�B�S`D
8A0A(B BBBDP
hHZ
8O0C(B BBBL^
8J0I(D BBBEb
8M0I(D BBBNfhBp\hA`D
8A0A(B BBBEh
hHrhEpBxB�^`D
8A0A(B BBBAy
hBpBxB�Q zRx�`������(]����T��� �`����Hp|
A(�԰���E�G�I��
AAA������E�w����E�S
A(����%`<��� P���>E�`
KH
At0���%`�L����\L�IJ��XS����E�V����2Ka
A$�4���-E�G�G WAA(<���3E�D�D cAADP���;EARdp���'E�N
E�����/E�Q
J�����/E�Q
JL�����oF�B�B �B(�A0�A8�D`�
8A0A(B BBBG\ȷ���F�L�E �E(�E0�A8�G@S
8G0A(B BBBDD8H0A(B BBBl���h<�p����F�E�D �A(�G@I
(A ABBJ�����YL�����F�G�B �B(�A0�A8�G��
8A0A(B BBBC,	X���)E�L
GH(L	h���VE�D�K h
AABx	����$�	�����A�C
A�h
C�	@���%AA^(�	T���%
A�C
I������
A$zRx�������,�|��L8
��xF�B�B �B(�D0�A8�J��
8A0A(B BBBE$zRx��������,3|��P�
���F�B�B �B(�A0�A8�G� I�!
8A0A(B BBBJ$zRx��!������,�{��LT`��JF�B�B �B(�D0�A8�D�
8A0A(B BBBGL�`���F�B�A �A(�G0n
(D ABBH_
(D ABBH���oNZX���D$���F�B�B �A(�A0�G�A
0A(A BBBDDl��eF�E�E �E(�H0�H8�G@n8A0A(B BBB���`1 1� ���ȋP���،�H���b��c͎i܎l��n�s�s�v����
��� �� ���o�x
@
5�� ��	���o���oH���o�o�
���o�� �� 0@P`p�������� 0@P`p�������� 0@P`p�������� 0@P`p��������������ˏ
GA$3h87800
GA$3c878��
GA$3s878��
GA$3e878��GA$3a1�0�0GA$3a1�0�0
GA$3p878�0�0GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFY�GA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFY�GA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFY�GA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFY�GA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFY�GA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA$3a1�0�0GA$3a1��GA$3a1����GA$3a1�0i1
GA$3p878p1�3GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s878�0GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA* 0GA!stack_realignGA*GA+stack_clashGA*cf_protectionGA+omit_frame_pointerGA*
GA*GOW*EGA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3p878�3�3GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�3K5GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878K5K5GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878P5\5GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878`5�5GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�5\6GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878`67GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p8787*DGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p8780DeDGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878pD�JGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�JQGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878QQGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878Q�SGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�S�SGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�SoTGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878pT�XGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�X�YGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878Z�ZGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�Z�ZGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�Z�`GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�`>aGA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878@a�}GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�}��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p878�+�GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3p8780���GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA*FORTIFYGA+GLIBCXX_ASSERTIONS
GA$3h87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3c878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3s87800GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realign
GA$3e878��GA$gcc 8.3.1 20191121
GA*GOW*EGA*GA+stack_clashGA*cf_protection
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GA!GA+omit_frame_pointerGA*GA!stack_realignGA$3a1����GA$3a1����GA$3a1��GA$3a1����cmp-3.6-6.el8.x86_64.debug�=��7zXZ�ִF!t/���H]?�E�h=��ڊ�2N���j� ��Z�'kOK&�WM�� ���
t*���Н����r�`y5!�~�zt`E��!��Y���œ�}p���i:H�A��4�c����5�E%��B �%5>'�F��r���Y�|Nh���v{7\���w���j8�1&���+��#-2aTM	æW��9���u��#[�Š4�Z�|�:v������q�o�p�7r�
��@y�¨k�5������"���わ�\- �`@۸��p��ا,M�|gX���Cz
�ǞTn7N��#=U���D@R�,+�Ҹ�"%�j�k��
.���sS"�ɗ����b��-D�����)E
�̠G��:�*suP.�@�^�����Z�-b�ل�������#�d���ҔM�P�ܣ�ٌ��y?�������B�e$��|˧�D��M�W��@W�b޿��`
���7��b��T�*?�r�o;�$kp�V�i �fM�O���#I\(�l�C����2	�0���FJ{ۿ��fkA@P�Eܧ��L�(��3�J��F�+Cb��Y�(���E��V�C�{�6!��Bs�-k��a�ė���9@_;�M`���&-Rkp�d����z��T�\��f
[���+�j��:��ݞAΣѻ���a,����
"���
�g9���E?;,��g�e���K���3�A���h�<u�'mد@�����iwt�H�,��K�V��Y#d���X�j��{����鵚��S����\�(랯���܉j�=W{���[6q��B^�d6�?�o�#�\�2����m*�}8�[��l7��-�J�=oM�.��Q�>�o���2��G���x�7��`�f��`���y��KƄR��ݔH`8R��¸�֒rp�H��\C2#/
��z�)����om"��N�2��X�*KiS�O:��!�Og��V�X-	���1J�s��~I��7�2n}0l��oG:/�uQ/G�_�I}AP��˺3�IS"0b���Eȶp�E��)�1p��#�љ�6��(���,*�B쨑��$&e*��&�i�	3��4ѩ؄ HW,c�����Y`����a��N�F'��n?� ©eڏY���
awxp�7L���?�|�td��j�9Gtf:~�߀
���*#XG�ʦ�D����ڍA*W�cL��~�̷#�bx%D�hR��VE 
�*0ǜ���Mj�k�މ&Ɋ�����k:��w���.GVҶUJ$�d��W�s-�Z����d���W)&Ki��;�8���{�	��M0{��*N�t�`�.vL̷1"�q͠�����o���Ǘ|����0[�e=ؼ�e��V5�PH����C!���>�<IF���n�FВv��8��=�3.^i����1�P��n��X!�k���~��k�v�c�e�6KKh�e�r�c���J�
a�n�ފ1(�����6�௚����b�X����i90��#,��'�|9�0�
��npۇ�g��k����@\0PG�:yi;Յ1Iu˾S�Z�0tb9�f~^�˫��|j]YĤ�-��Lr�M��F�T��P���D��;���ȏq��1;q4���g�YZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdatapp�� &�� 4��$G���o��DQ@@8Yx
x
5a���o�
�
�n���oHH`}���B���������������g�����
����� �ԖԖ4������ ���� ���� �� ��� ������ ��@�� � � �H* 
h�`�D� `� /����>

SILENT KILLER Tool